PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA004025-PA
Common NameOsI_02925
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HSF
Protein Properties Length: 312aa    MW: 34080.6 Da    PI: 6.8615
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA004025-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind881.2e-2727123298
                       HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTTXTTSEEEEESXXXXXXXXXX CS
      HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekkskskekiweFkhksFkkgkkell 94 
                       F+ k+y+++ d++++ l++w +++nsfvv+d+  f++ +Lp +Fkh nf+SFvRQLn+Y     +   + +k +++ weF+h+sF +g+++ll
  BGIOSGA004025-PA  27 FVAKTYQMVCDPRTDALVRWGRDNNSFVVVDPAAFSQLLLPCFFKHGNFSSFVRQLNTYVSIIQSPAPGFRKVHPDRWEFAHESFLRGQTHLL 119
                       9**********************************************************877766666666667999**************** PP

                       XXXX CS
      HSF_DNA-bind  95 ekik 98 
                        +i+
  BGIOSGA004025-PA 120 PRIR 123
                       9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.6E-3320119IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467852.27E-3123123IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004153.0E-4323125IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.4E-102750IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004474.7E-2627123IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.4E-106577IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.4E-107890IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDGLHTELAL GLIGCCGGDG QQQTAPFVAK TYQMVCDPRT DALVRWGRDN NSFVVVDPAA  60
FSQLLLPCFF KHGNFSSFVR QLNTYVSIIQ SPAPGFRKVH PDRWEFAHES FLRGQTHLLP  120
RIRGNVGRGG GCGGGRAGQG AALFEEVQRL RHEQTAIGEE LRDEPAAAGD ERRPDQLMSF  180
LSKLADDPNA VTGHLLEQSA ERKRRRQHLP SHEPTVCPLP PAPPPQPPQP LLALAGAAAM  240
DGTYWWTTEH HHHHHHQMKP MTVLPSLEPP TASCGVHQVP ELGGGGVMGL TTDGEAKVEP  300
PFPFCLLGQA FF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B5e-201712619130Heat shock factor protein 1
5d5v_B5e-201712619130Heat shock factor protein 1
5d5v_D5e-201712619130Heat shock factor protein 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RGGGCGGGR
2201205RKRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.400150.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329795030.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636084.11e-166PREDICTED: heat stress transcription factor C-1a
SwissprotQ6VBA41e-168HFC1A_ORYSJ; Heat stress transcription factor C-1a
TrEMBLB8ABZ50.0B8ABZ5_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA004025-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24520.12e-48heat shock transcription factor C1